PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538735.1_FGP013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 285aa    MW: 30400.4 Da    PI: 4.3049
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538735.1_FGP013genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS271.52.7e-835728074299
               GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerL 165
                         + +la+++   e++P+lkf+h+taNqaIlea++g+++vH+iDf+++qGlQWpaL+qaLa Rp+gpp lRiTg+g+p+++ ++el+ +g rL
  KN538735.1_FGP013  57 AAAVLAMRREEEEACPYLKFAHFTANQAILEAFHGCDHVHVIDFSLMQGLQWPALIQALALRPGGPPFLRITGIGPPSPTGRDELRDVGLRL 148
                        5556666677789******************************************************************************* PP

               GRAS 166 akfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerf 257
                        a++A++++v+f+f+ ++a++l+++++++L++ pgEa+a n+vlqlhrll ++++++  +d+vL++v s++Pk+++v+eqeadhn++ Fl+rf
  KN538735.1_FGP013 149 ADLARSVRVRFSFRGVAANSLDEVRPWMLQIAPGEAVAFNSVLQLHRLLGDPADQAP-IDAVLDCVASVRPKIFTVIEQEADHNKTGFLDRF 239
                        *************************************************99998888.********************************** PP

               GRAS 258 lealeyysalfdsleaklpreseerikvErellgreivnvva 299
                        +eal yysa+fdsl+a  ++   + + + +++l+rei+++  
  KN538735.1_FGP013 240 TEALFYYSAVFDSLDAA-SASGGAGNAMAEAYLQREICDIMQ 280
                        **************998.44558888888889*******976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.6451285IPR005202Transcription factor GRAS
PfamPF035149.4E-8157280IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MDPAASSGLD AGFLPPPAAV APDDAVGYYD PPAGADVDAA ALPEFAAAFP PCAPDAAAAV  60
LAMRREEEEA CPYLKFAHFT ANQAILEAFH GCDHVHVIDF SLMQGLQWPA LIQALALRPG  120
GPPFLRITGI GPPSPTGRDE LRDVGLRLAD LARSVRVRFS FRGVAANSLD EVRPWMLQIA  180
PGEAVAFNSV LQLHRLLGDP ADQAPIDAVL DCVASVRPKI FTVIEQEADH NKTGFLDRFT  240
EALFYYSAVF DSLDAASASG GAGNAMAEAY LQREICDIMQ FGYSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-406927185287GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624056.11e-148PREDICTED: DELLA protein SLN1
SwissprotQ9LQT86e-81GAI_ARATH; DELLA protein GAI
TrEMBLA0A0D3ERT51e-148A0A0D3ERT5_9ORYZ; Uncharacterized protein
TrEMBLB7F9I51e-148B7F9I5_ORYSJ; Os01g0646300 protein
TrEMBLB8A6W01e-148B8A6W0_ORYSI; Putative uncharacterized protein
STRINGLOC_Os01g45860.11e-148(Oryza sativa Japonica Group)
STRINGBGIOSGA001121-PA1e-148(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.12e-69GRAS family protein